Cart summary

You have no items in your shopping cart.

FAM131B Rabbit Polyclonal Antibody (Biotin)

FAM131B Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2088328

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088328
CategoryAntibodies
DescriptionFAM131B Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM131B
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW38kDa
UniProt IDQ86XD5
Protein SequenceSynthetic peptide located within the following region: IEWQGWGKTPAVQPQHSHESVRRDTDAYSDLSDGEKEARFLAGVMEQFAI
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFAM131B, KIAA0773,
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.