Cart summary

You have no items in your shopping cart.

FAM117A Rabbit Polyclonal Antibody (HRP)

FAM117A Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2088332

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088332
CategoryAntibodies
DescriptionFAM117A Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM117A
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW50kDa
UniProt IDQ9C073
Protein SequenceSynthetic peptide located within the following region: SWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASP
NCBINP_110429
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
NoteFor research use only
Expiration Date12 months from date of receipt.
  • FAM117A Rabbit Polyclonal Antibody (HRP) [orb2088335]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl