You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578162 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to FAH |
Target | FAH |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAH |
Protein Sequence | Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
UniProt ID | P16930 |
MW | 46kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000128 |
FAH antibody - C-terminal region (orb578162) validated by WB using Jurkat cell lysate at 2.5 ug/ml.
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Immunohistochemistry with human liver, mouse KO tissue.
Immunohistochemistry with human liver, mouse KO tissue.
Rabbit Anti-FAH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |