EZH1 Rabbit Polyclonal Antibody

• Catalog Number: orb329961
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EZH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EZH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 85kDa
• Target: EZH1
• UniProt ID: Q92800
• Protein Sequence: Synthetic peptide located within the following region: MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQ
• NCBI: NP_001982
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA0388 antibody, anti KMT6B antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Spleen tissue at an antibody concentration of 5 ug/mL using anti-EZH1 antibody (orb329961).

WB Suggested Anti-EZH1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate, There is BioGPS gene expression data showing that EZH1 is expressed in COLO205.