You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329961 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EZH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EZH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 85kDa |
Target | EZH1 |
UniProt ID | Q92800 |
Protein Sequence | Synthetic peptide located within the following region: MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQ |
NCBI | NP_001982 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti KIAA0388 antibody, anti KMT6B antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of COLO205 cell lysate tissue using EZH1 antibody
ELISA, IF, IHC-P, WB | |
Human, Monkey, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating