Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EYA1 Rabbit Polyclonal Antibody

SKU: orb329658

Description

EYA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EYA1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human EYA1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EYA1
TargetEYA1
Protein SequenceSynthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP
Molecular Weight64 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BOP antibody, anti BOR antibody, anti MGC141875 antibody

Similar Products

  • EYA1/EYA4 Antibody [orb676459]

    ELISA,  IHC

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • EYA1 Rabbit Polyclonal Antibody [orb626864]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • EYA1 Rabbit Polyclonal Antibody [orb234835]

    IHC,  WB

    Human, Monkey, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • EYA1 Antibody (N-term) [orb1937466]

    WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EYA1 Rabbit Polyclonal Antibody [orb312235]

    IF,  IHC-Fr,  IHC-P

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

EYA1 Rabbit Polyclonal Antibody

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).

EYA1 Rabbit Polyclonal Antibody

WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_742057

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

EYA1 Rabbit Polyclonal Antibody (orb329658)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry