You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329658 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EYA1 |
Target | EYA1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EYA1 |
Protein Sequence | Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP |
UniProt ID | Q99502 |
MW | 64 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti BOP antibody, anti BOR antibody, anti MGC1418 Read more... |
Note | For research use only |
NCBI | NP_742057 |
Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).
WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.
IH, WB | |
Human, Mouse, Primate, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |