You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EYA1 |
| Target | EYA1 |
| Protein Sequence | Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP |
| Molecular Weight | 64 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−EYA1 Rabbit Polyclonal Antibody [orb626864]
ELISA, IF, IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgEYA1 Rabbit Polyclonal Antibody [orb234835]
IHC, WB
Human, Monkey, Mouse, Rat, Zebrafish
Rabbit
Polyclonal
Unconjugated
200 μl, 30 μl, 100 μl, 50 μlEYA1 Rabbit Polyclonal Antibody [orb1816912]
WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human ACHN Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-EYA1 antibody (orb329658).

WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.
Documents Download
Request a Document
Protocol Information
EYA1 Rabbit Polyclonal Antibody (orb329658)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








