Cart summary

You have no items in your shopping cart.

EXTL2 Rabbit Polyclonal Antibody (Biotin)

EXTL2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2118730

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2118730
CategoryAntibodies
DescriptionEXTL2 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human EXTL2
Protein SequenceSynthetic peptide located within the following region: GSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQN
UniProt IDQ9UBQ6
MW36kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesEXTR2
NoteFor research use only
NCBIXP_005270678
  • EXTL2 Rabbit Polyclonal Antibody (Biotin) [orb446786]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μl