You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577779 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EXOSC7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | EXOSC7 |
UniProt ID | B2RDZ9 |
Protein Sequence | Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC |
NCBI | NP_055819 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p8, EAP1, RRP42, Rrp42p, hRrp42p Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-EXOSC7 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-EXOSC7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. EXOSC7 is supported by BioGPS gene expression data to be expressed in MCF7.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |