You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577900 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EXOSC6 |
Target | EXOSC6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC6 |
Protein Sequence | Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK |
UniProt ID | Q5RKV6 |
MW | 30kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | p11, EAP4, MTR3, Mtr3p, hMtr3p |
Note | For research use only |
NCBI | NP_478126 |
Rabbit Anti-EXOSC6 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-EXOSC6 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-EXOSC6 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Mouse, Porcine, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |