You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577839 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EXOSC4 |
| Target | EXOSC4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC4 |
| Protein Sequence | Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
| UniProt ID | Q9NPD3 |
| MW | 27kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SKI6, p12A, RRP41, Ski6p, RRP41A, Rrp41p, hRrp41p |
| Research Area | Epigenetics & Chromatin, Molecular Biology |
| Note | For research use only |
| NCBI | NP_061910 |

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-EXOSC4 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-EXOSC4 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-EXOSC4 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review