EXOSC4 Rabbit Polyclonal Antibody

• Catalog Number: orb577839
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EXOSC4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: EXOSC4
• UniProt ID: Q9NPD3
• Protein Sequence: Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
• NCBI: NP_061910
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SKI6, p12A, RRP41, Ski6p, RRP41A, Rrp41p, hRrp41p
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-EXOSC4 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-EXOSC4 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-EXOSC4 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.