You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324836 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EXOSC10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC10 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 97kDa |
Target | EXOSC10 |
UniProt ID | Q01780 |
Protein Sequence | Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
NCBI | NP_001001998 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti p2 antibody, anti p3 antibody, anti p4 antibo Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-EXOSC10 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-EXOSC10 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, EXOSC10 is supported by BioGPS gene expression data to be expressed in Jurkat.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |