You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2695002 |
---|---|
Category | Proteins |
Description | Avexitide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist. |
Target | GCGR |
Purity | ≥95% |
Protein Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
MW | 3369.83 |
Solubility (25°C) | Water: 50 mg/mL |
CAS Number | 133514-43-9 |
Formula | C149H234N40O47S1 |
Note | For research use only |
> 95% by HPLC | |
3369.8 Da Da | |
H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
98.65% | |
2051593-46-3 | |
3549.91 | |
C155H246N40O53S |