Cart summary

You have no items in your shopping cart.

Evl Rabbit Polyclonal Antibody (FITC)

Evl Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2124786

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2124786
CategoryAntibodies
DescriptionEvl Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Mouse Evl
Protein SequenceSynthetic peptide located within the following region: FSNAMLFALNIMNSQEGGPSTQRQVQNGPSPEEMDIQRRQVMEQQHRQES
UniProt IDQ6PB99
MW42kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesAI528774, b2b2600C, b2b2600Clo
NoteFor research use only
NCBINP_031991