ETV1 antibody

• Catalog Number: orb329990
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ETV1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ETV1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: ETV1
• UniProt ID: P50549
• Protein Sequence: Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
• NCBI: NP_004947
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp781L0674 antibody, anti ER81 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human brain tissue using ETV1 antibody

Western blot analysis of HT1080 cell lysate tissue using ETV1 antibody

Western blot analysis of HEK293 lysate tissue using ETV1 antibody