ETV1 Rabbit Polyclonal Antibody

SKU: orb329990

Description

ETV1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ETV1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ETV1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ETV1
• Target: ETV1
• Protein Sequence: Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
• Molecular Weight: 55kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp781L0674 antibody, anti ER81 antibody, anti MGC104699 antibody, anti MGC120533 antibody, anti MGC120534 antibody

Quick Database Links

Gene Symbol

ETV1

UniProt

P50549

RefSeq (Protein):NP_004947