ETS1 Rabbit Polyclonal Antibody

• Catalog Number: orb592832
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ETS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ETS1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: ETS1
• UniProt ID: P14921
• Protein Sequence: Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
• NCBI: NP_005229
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p54, ETS-1, EWSR2, c-ets-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Human Pancrease

Rabbit Anti-ETS1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ETS1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.

Sample Tissue: Human NCI-H226 Whole Cell, Antibody Dilution: 7 ug/ml.

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.