FAM62B Rabbit Polyclonal Antibody

SKU: orb325485

Description

FAM62B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ESYT2. It is suitable for IP, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human FAM62B. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IP, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM62B
• Target: ESYT2
• Protein Sequence: Synthetic peptide located within the following region: NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS
• Molecular Weight: 102 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CHR2SYT antibody, anti ESYT2 antibody, anti KIAA1228 antibody, anti E-Syt2 antibody, anti FAM62B antibody

Quick Database Links

Gene Symbol

ESYT2

UniProt

A0FGR8

RefSeq (Protein):NP_065779