ESRRG Rabbit Polyclonal Antibody

• Catalog Number: orb329614
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ESRRG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: ESRRG
• UniProt ID: P62508
• Protein Sequence: Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
• NCBI: NP_996318
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ERR3 antibody, anti NR3B3 antibody, anti ERRg
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse small intestine (M-IN), Antibody concentration: 3 ug/mL.

Human Lung

WB Suggested Anti-ESRRG Antibody Titration: 0.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.