ESRRB Rabbit Polyclonal Antibody

• Catalog Number: orb574109
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ESRRB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48 kDa
• Target: ESRRB
• UniProt ID: O95718
• Protein Sequence: Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
• NCBI: NP_004443
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ERR2, ERRb, ESRL2, NR3B2, DFNB35, ERRbeta2, ERR be
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms of 48 and 63 kDa are observed in some samples. Recommended dilution for this antibody is 1-3 ug/ml.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Multiple isoforms contain this peptide sequence from 63 kDa to 48 kDa.

Lane 1: 25 ug mouse ES cells, Lane 2: 25 ug mouse ES cells overexpressing FLAG EsrrB (mouse), Lane 3: 25 ug chromatin fraction CV1 cells, Lane 4: 25 ug chromatin fraction CV1 cells overexpressing FLAG EsrrB (mouse), Lane 5: 25 ug chromatin fraction CV1 cells overexpressing FLAG EsrrB-Deltacter (mouse), Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:3000, Gene Name: ESRRB.

WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.