Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ESRRB Rabbit Polyclonal Antibody

SKU: orb574109

Description

Rabbit polyclonal antibody to ESRRB

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB
TargetESRRB
Protein SequenceSynthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
Molecular Weight48 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ERR2, ERRb, ESRL2, NR3B2, DFNB35, ERRbeta2, ERR beta-2

Similar Products

  • ESRRB Rabbit Polyclonal Antibody [orb573885]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Estrogen Related Receptor beta Rabbit Polyclonal Antibody [orb500654]

    WB

    Bovine, Canine, Human, Porcine, Rabbit, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ESRRB Rabbit Polyclonal Antibody [orb626825]

    ELISA,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ESRRB Rabbit Polyclonal Antibody [orb2951243]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ESRRB Rabbit Polyclonal Antibody (FITC) [orb2142688]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ESRRB Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms of 48 and 63 kDa are observed in some samples. Recommended dilution for this antibody is 1-3 ug/ml.

ESRRB Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Multiple isoforms contain this peptide sequence from 63 kDa to 48 kDa.

ESRRB Rabbit Polyclonal Antibody

Lane 1: 25 ug mouse ES cells, Lane 2: 25 ug mouse ES cells overexpressing FLAG EsrrB (mouse), Lane 3: 25 ug chromatin fraction CV1 cells, Lane 4: 25 ug chromatin fraction CV1 cells overexpressing FLAG EsrrB (mouse), Lane 5: 25 ug chromatin fraction CV1 cells overexpressing FLAG EsrrB-Deltacter (mouse), Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:3000, Gene Name: ESRRB.

ESRRB Rabbit Polyclonal Antibody

WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004443

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ESRRB Rabbit Polyclonal Antibody (orb574109)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry