You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575669 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Estrogen Receptor beta |
Target | ESR2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Human, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ESR2 |
Protein Sequence | Synthetic peptide located within the following region: SYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPG |
UniProt ID | Q92731 |
MW | 56kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Erb, ESRB, ODG8, ESTRB, NR3A2, ER-BETA, ESR-BETA |
Note | For research use only |
NCBI | NP_001428 |
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Rat Brain
WB Suggested Anti-ESR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: ACHN cell lysate.
WB Suggested Anti-ESR2 antibody Titration: 1 ug/ml, Sample Type: Human heart.
WB Suggested Anti-ESR2 antibody Titration: 1 ug/ml, Sample Type: Human liver.
ELISA, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |