You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330994 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ERP44 |
| Target | ERP44 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TXNDC4 |
| Protein Sequence | Synthetic peptide located within the following region: LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE |
| UniProt ID | Q9BS26 |
| MW | 45kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti ERP44 antibody, anti KIAA0573 antibody, anti Read more... |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_055866 |
| Expiration Date | 12 months from date of receipt. |

WB Suggested Anti-TXNDC4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review