ERLIN2 Rabbit Polyclonal Antibody

• Catalog Number: orb326257
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERLIN2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: ERLIN2
• UniProt ID: O94905
• Protein Sequence: Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
• NCBI: NP_009106
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C8orf2 antibody, anti Erlin-2 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ERLIN2 antibody - middle region (orb326257) validated by WB using HeLa, aT3 cells at 1:200 / 1:1000.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.