You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326257 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ERLIN2 |
Target | ERLIN2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2 |
Protein Sequence | Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN |
UniProt ID | O94905 |
MW | 38kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti C8orf2 antibody, anti Erlin-2 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_009106 |
ERLIN2 antibody - middle region (orb326257) validated by WB using HeLa, aT3 cells at 1:200 / 1:1000.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.
IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |