Cart summary

You have no items in your shopping cart.

ERI2 Rabbit Polyclonal Antibody (FITC)

ERI2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2109195

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2109195
CategoryAntibodies
DescriptionERI2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ERI2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW37kDa
UniProt IDA8K979
Protein SequenceSynthetic peptide located within the following region: LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
NCBINP_542394
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesEXOD1, ZGRF5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.