ERI2 antibody

• Catalog Number: orb325750
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERI2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERI2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: ERI2
• UniProt ID: A8K979
• Protein Sequence: Synthetic peptide located within the following region: LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
• NCBI: NP_542394
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA1504 antibody, anti MGC16943 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Jurkat cell lysate tissue using ERI2 antibody

Western blot analysis of human HepG2 tissue using ERI2 antibody

Western blot analysis of human 721_B tissue using ERI2 antibody