ERI2 Rabbit Polyclonal Antibody

• Catalog Number: orb325750
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERI2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERI2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: ERI2
• UniProt ID: A8K979
• Protein Sequence: Synthetic peptide located within the following region: LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
• NCBI: NP_542394
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA1504 antibody, anti MGC16943 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, ERI2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, ERI2 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-ERI2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.