ERCC5 Rabbit Polyclonal Antibody

• Catalog Number: orb582270
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ERCC5
• Target: ERCC5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ERCC5
• Protein Sequence: Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES
• UniProt ID: P28715
• MW: 133 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: XPG, UVDR, XPGC, COFS3, ERCM2, ERCC5-201
• Note: For research use only

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The peptide sequence is present in 47 kDa and 27 kDa isoforms. The protein may be modified by phosphorylation.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Type: Ovary tumor lysates, Antibody dilution: 1.0 ug/ml.