EPHA7 Rabbit Polyclonal Antibody

• Catalog Number: orb585783
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EPHA7
• Target: EPHA7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7
• Protein Sequence: Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL
• UniProt ID: Q15375
• MW: 112kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EHK3, EK11, EHK-3, HEK11
• Research Area: Neuroscience, Protein Biochemistry, Stem Cell & De
• Note: For research use only
• NCBI: NP_004431

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-EPHA7 Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell. EPHA7 is supported by BioGPS gene expression data to be expressed in OVCAR3.