You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585783 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EPHA7 |
Target | EPHA7 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7 |
Protein Sequence | Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL |
UniProt ID | Q15375 |
MW | 112kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EHK3, EK11, EHK-3, HEK11 |
Note | For research use only |
NCBI | NP_004431 |
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-EPHA7 Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell. EPHA7 is supported by BioGPS gene expression data to be expressed in OVCAR3.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |