Cart summary

You have no items in your shopping cart.

ENY2 Rabbit Polyclonal Antibody (Biotin)

ENY2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2083993

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2083993
CategoryAntibodies
DescriptionENY2 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ENY2
Protein SequenceSynthetic peptide located within the following region: QMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLE
UniProt IDQ9NPA8
MW11kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDC6, Sus1, e(y)2
NoteFor research use only
NCBINP_064574
  • ENY2 Rabbit Polyclonal Antibody (Biotin) [orb450059]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μl