You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579336 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Autotaxin |
Target | ENPP2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ENPP2 |
Protein Sequence | Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA |
UniProt ID | Q13822 |
MW | 99 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IA Read more... |
Note | For research use only |
NCBI | NP_001035181 |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in isoforms of 105 and 102 kDa, and the protein is processed to a 95 kDa mature form. The protein may be modified by glycosylation.
WB Suggested Anti-ENPP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate.
FC, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |