ENPP2 Rabbit Polyclonal Antibody

• Catalog Number: orb579336
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Autotaxin
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENPP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 99 kDa
• Target: ENPP2
• UniProt ID: Q13822
• Protein Sequence: Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
• NCBI: NP_001035181
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ATX, NPP2, ATX-X, PDNP2, LysoPLD, AUTOTAXIN, PD-IA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in isoforms of 105 and 102 kDa, and the protein is processed to a 95 kDa mature form. The protein may be modified by glycosylation.

WB Suggested Anti-ENPP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: COLO205 cell lysate.