Cart summary

You have no items in your shopping cart.

EMX2 Rabbit Polyclonal Antibody (HRP)

EMX2 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2142742

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2142742
CategoryAntibodies
DescriptionEMX2 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human EMX2
Protein SequenceSynthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
UniProt IDQ04743
MW28kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only
NCBINP_004089
  • EMX2 Rabbit Polyclonal Antibody (HRP) [orb482528]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl