TMEM93 Rabbit Polyclonal Antibody

• Catalog Number: orb579245
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TMEM93
• Target: EMC6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM93
• Protein Sequence: Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
• UniProt ID: Q9BV81
• MW: 12kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TMEM93, RAB5IFL
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_112588

EMC6 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579245 with 1:200 dilution. Western blot was performed using orb579245 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: EMC6 IP with orb579245 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Positive control (+): 293T (2T), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.

WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat.