You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579245 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TMEM93 |
| Target | EMC6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM93 |
| Protein Sequence | Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
| UniProt ID | Q9BV81 |
| MW | 12kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TMEM93, RAB5IFL |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_112588 |

EMC6 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579245 with 1:200 dilution. Western blot was performed using orb579245 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: EMC6 IP with orb579245 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Positive control (+): 293T (2T), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.

WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat.
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review