You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579245 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TMEM93 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM93 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 12kDa |
Target | EMC6 |
UniProt ID | Q9BV81 |
Protein Sequence | Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG |
NCBI | NP_112588 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TMEM93, RAB5IFL Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EMC6 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579245 with 1:200 dilution. Western blot was performed using orb579245 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: EMC6 IP with orb579245 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
Positive control (+): 293T (2T), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.
WB Suggested Anti-TMEM93 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. EMC6 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |