You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326740 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EMC10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human EMC10 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | EMC10 |
UniProt ID | Q5UCC4 |
Protein Sequence | Synthetic peptide located within the following region: PTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMM |
NCBI | NP_996261 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti EMC10 antibody, anti C19orf63 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: THP-1 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.