ELOVL5 Rabbit Polyclonal Antibody

• Catalog Number: orb580812
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ELOVL5
• Target: ELOVL5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5
• Protein Sequence: Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
• UniProt ID: Q9NYP7
• MW: 35kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HELO1, SCA38, dJ483K16.1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_068586

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 0.2 ug/ml.

WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.