You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580812 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ELOVL5 |
| Target | ELOVL5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5 |
| Protein Sequence | Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
| UniProt ID | Q9NYP7 |
| MW | 35kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HELO1, SCA38, dJ483K16.1 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_068586 |

Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 0.2 ug/ml.

WB Suggested Anti-ELOVL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.
WB | |
Canine, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review