ELOA Rabbit Polyclonal Antibody

• Catalog Number: orb592854
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ELOA
• Target: ELOA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TCEB3
• Protein Sequence: Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR
• UniProt ID: Q14241
• MW: 87kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SIII, TCEB3, TCEB3A, SIII p110
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_003189

Human Pancrease

WB Suggested Anti-TCEB3 Antibody Titration: 7.5 ug/ml, Positive Control: Transfected 293T. TCEB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.