You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
ELOA Rabbit Polyclonal Antibody
Catalog Number: orb592854
| Catalog Number | orb592854 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ELOA |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Canine, Guinea pig, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TCEB3 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 87kDa |
| Target | ELOA |
| UniProt ID | Q14241 |
| Protein Sequence | Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR |
| NCBI | NP_003189 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | SIII, TCEB3, TCEB3A, SIII p110 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human Pancrease
WB Suggested Anti-TCEB3 Antibody Titration: 7.5 ug/ml, Positive Control: Transfected 293T. TCEB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
- Item 1 of 2
Anti-TCEB3 Antibody [orb224020]
IH, WB
Human, Primate, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
- Item 1 of 3
Elongin A1 rabbit pAb [orb765128]
ELISA, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
