You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573873 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ELF2 |
Target | ELF2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ELF2 |
Protein Sequence | Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE |
UniProt ID | Q15723 |
MW | 57kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EU32, NERF, NERF-2, NERF-1A, NERF-1B, NERF-1a,b |
Note | For research use only |
NCBI | NP_006865 |
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-ELF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ELF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ELF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |