ELF1 Rabbit Polyclonal Antibody

• Catalog Number: orb329885
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ELF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse ELF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: ELF1
• UniProt ID: Q60775
• Protein Sequence: Synthetic peptide located within the following region: DDIVAPITHVSVTLDGIPEVMETQQVQETNADSPGASSPEQRKRKKGRKT
• NCBI: NP_031946
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti p70 antibody, anti Sts1 antibody, anti Elf-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ELF1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate.

WB Suggested Anti-ELF1 antibody Titration: 1 ug/mL, Sample Type: Human Hela.

WB Suggested Anti-ELF1 antibody Titration: 1 ug/mL, Sample Type: Human MCF7.