You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585008 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EIF6 |
Target | EIF6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Frog, Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: AVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHA |
UniProt ID | P56537 |
MW | 27kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CAB, EIF3A, eIF-6, p27BBP, ITGB4BP, b(2)gcn, p27(B Read more... |
Note | For research use only |
NCBI | NP_002203 |
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. EIF6 is supported by BioGPS gene expression data to be expressed in 721_B.
Rabbit Anti-EIF6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-EIF6 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-EIF6 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. EIF6 is supported by BioGPS gene expression data to be expressed in HeLa.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |