You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327237 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IF5A1 |
Target | EIF5A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1 |
Protein Sequence | Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK |
UniProt ID | P63241 |
MW | 17 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti EIF5A antibody, anti antibody |
Note | For research use only |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment.
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
IF, WB | |
Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |