EIF5A Rabbit Polyclonal Antibody

• Catalog Number: orb327237
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IF5A1
• Target: EIF5A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1
• Protein Sequence: Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK
• UniProt ID: P63241
• MW: 17 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EIF5A antibody, anti antibody
• Note: For research use only

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.