Cart summary

You have no items in your shopping cart.

    EIF4G2 Antibody - C-terminal region : HRP

    EIF4G2 Antibody - C-terminal region : HRP

    Catalog Number: orb2125778

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2125778
    CategoryAntibodies
    DescriptionEIF4G2 Antibody - C-terminal region : HRP
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EIF4G2
    Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    ConjugationHRP
    MW39kDa
    UniProt IDP78344
    Protein SequenceSynthetic peptide located within the following region: KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
    NCBIAAH14930
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    Alternative namesP97, AAG1, DAP5, NAT1
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars