DDX48 Rabbit Polyclonal Antibody

• Catalog Number: orb324643
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF4A3
• Target: EIF4A3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX48
• Protein Sequence: Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
• UniProt ID: P38919
• MW: 45kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DDX48 antibody, anti NUK34 antibody, anti NMP
• Note: For research use only
• NCBI: NP_055555

WB Suggested Anti-DDX48 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, EIF4A3 is supported by BioGPS gene expression data to be expressed in HepG2.