EIF3M Rabbit Polyclonal Antibody

• Catalog Number: orb580363
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3M
• Target: EIF3M
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
• Protein Sequence: Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
• UniProt ID: Q7L2H7
• MW: 43 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: B5, GA17, PCID1, TANGO7, hfl-B5
• Research Area: Epigenetics, Infectious Diseases
• Note: For research use only
• NCBI: NP_006351

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Human kidney

WB Suggested Anti-EIF3M Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that EIF3M is expressed in HepG2.