EIF3K Rabbit Polyclonal Antibody

• Catalog Number: orb331174
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3K
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: EIF3K
• UniProt ID: Q9UBQ5
• Protein Sequence: Synthetic peptide located within the following region: AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD
• NCBI: NP_037366
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARG134 antibody, anti EIF3-p28 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EIF3K antibody - C-terminal region (orb331174) validated by WB using U937 Cell Lysate at 1.0 ug/ml.

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.