You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581103 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EIF3H |
Target | EIF3H |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EIF3H |
Protein Sequence | Synthetic peptide located within the following region: LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPP |
UniProt ID | O15372 |
MW | 40kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EIF3S3, eIF3-p40, eIF3-gamma |
Note | For research use only |
NCBI | NP_003747 |
WB Suggested Anti-EIF3H Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Other | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |