EIF3G Rabbit Polyclonal Antibody

• Catalog Number: orb577616
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF3G
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF3G
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: EIF3G
• UniProt ID: O75821
• Protein Sequence: Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
• NCBI: NP_003746
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: EIF3G, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: EIF3G.

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. EIF3G is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. EIF3G is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: EIF3G: Red DAPI:Blue, Gene Name: EIF3G.

WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.