Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EIF3G Rabbit Polyclonal Antibody

SKU: orb577616

Description

EIF3G Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EIF3G. It is suitable for IHC, IP, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human EIF3G. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, IP, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF3G
TargetEIF3G
Protein SequenceSynthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta

Similar Products

  • EIF3G Antibody (Center) [orb1930554]

    FC,  IHC-P,  WB

    Mouse, Other, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EIF3G Rabbit Polyclonal Antibody [orb2951288]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • EIF3G Rabbit Polyclonal Antibody [orb626676]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • EIF3G Rabbit Polyclonal Antibody [orb412253]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl, 30 μl
  • EIF3S4 Rabbit Polyclonal Antibody [orb577617]

    IHC,  WB

    Bovine, Canine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EIF3G Rabbit Polyclonal Antibody

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: EIF3G, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: EIF3G.

EIF3G Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. EIF3G is supported by BioGPS gene expression data to be expressed in HEK293T.

EIF3G Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. EIF3G is supported by BioGPS gene expression data to be expressed in MCF7.

EIF3G Rabbit Polyclonal Antibody

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: EIF3G: Red DAPI:Blue, Gene Name: EIF3G.

EIF3G Rabbit Polyclonal Antibody

WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003746

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
IP
Immunoprecipitation
View Protocol

EIF3G Rabbit Polyclonal Antibody (orb577616)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry