Cart summary

You have no items in your shopping cart.

EIF1AX Rabbit Polyclonal Antibody (HRP)

EIF1AX Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2117330

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2117330
CategoryAntibodies
DescriptionEIF1AX Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF1AX
Protein SequenceSynthetic peptide located within the following region: KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD
UniProt IDP47813
MW16kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesEIF1A, EIF4C, eIF-1A, eIF-4C, EIF1AP1
NoteFor research use only
NCBINP_001403
Expiration Date12 months from date of receipt.