Ehf Rabbit Polyclonal Antibody

• Catalog Number: orb576119
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ehf
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: Ehf
• UniProt ID: O70273
• Protein Sequence: Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ
• NCBI: NP_031940
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AU019492, 9030625L19Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Breast tissue at an antibody concentration of 5 ug/ml using anti-Ehf antibody (orb576119).

WB Suggested Anti-Ehf Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Mouse Brain.