EGR2 Rabbit Polyclonal Antibody

• Catalog Number: orb333122
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EGR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: EGR2
• UniProt ID: P11161
• Protein Sequence: Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
• NCBI: NP_000390
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CMT1D antibody, anti CMT4E antibody, anti DKF
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Human Intestine

Rabbit Anti-EGR2 Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.