You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333122 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EGR2 |
Target | EGR2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2 |
Protein Sequence | Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
UniProt ID | P11161 |
MW | 50kDa |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CMT1D antibody, anti CMT4E antibody, anti DKF Read more... |
Note | For research use only |
NCBI | NP_000390 |
Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.
Human Intestine
Rabbit Anti-EGR2 Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |