EGR2 Rabbit Polyclonal Antibody

SKU: orb333122

Description

EGR2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EGR2. It is suitable for IHC-P, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
• Target: EGR2
• Protein Sequence: Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
• Molecular Weight: 50kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CMT1D antibody, anti CMT4E antibody, anti DKFZp686J1957 antibody, anti FLJ14547 antibody, anti KROX20 antibody, anti AT591 antibody

Quick Database Links

Gene Symbol

EGR2

UniProt

P11161

RefSeq (Protein):NP_000390