EFNA4 Rabbit Polyclonal Antibody

• Catalog Number: orb585063
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EFNA4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24kDa
• Target: EFNA4
• UniProt ID: P52798
• Protein Sequence: Synthetic peptide located within the following region: GPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKI
• NCBI: NP_872632
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EFL4, EPLG4, LERK4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 20 ug A549 cell lysate, Lane 2: 20 ug H1437 cell lysate, Lane 3: 20 ug PC3 cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: EFNA4.

WB Suggested Anti-EFNA4 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell. EFNA4 is supported by BioGPS gene expression data to be expressed in MCF7.