Cart summary

You have no items in your shopping cart.

EEF1AKMT2 Rabbit Polyclonal Antibody (Biotin)

EEF1AKMT2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2113354

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113354
CategoryAntibodies
DescriptionEEF1AKMT2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LOC399818
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW32kDa
UniProt IDQ5JPI9
Protein SequenceSynthetic peptide located within the following region: SSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFRE
NCBINP_997719
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesEfm4, METTL10, C10orf138
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.