Cart summary

You have no items in your shopping cart.

Ecsit Rabbit Polyclonal Antibody (HRP)

Ecsit Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2130819

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2130819
CategoryAntibodies
DescriptionEcsit Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityMouse
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW50kDa
UniProt IDQ9QZH6
Protein SequenceSynthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN
NCBINP_036159
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesSit, Sitpec
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.