EBF1 Rabbit Polyclonal Antibody

• Catalog Number: orb577182
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EBF1
• Target: EBF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards (50ug) human EBF1.
• Protein Sequence: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
• UniProt ID: Q9UH73
• MW: 64 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EBF, COE1, OLF1, O/E-1
• Research Area: Cancer Biology, Epigenetics & Chromatin
• Note: For research use only

References

Lin Rao, Liping Cai, Lusheng Huang, Single-cell dynamics of liver development in postnatal pigs Sci Bull., 2095-9273 (2023)

PubMed: 37783617

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-EBF1 antibody (orb577182).

WB Suggested Anti-EBF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.