EBF1 antibody

• Catalog Number: orb577182
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EBF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards (50ug) human EBF1.
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purity: Affinity Purified
• Conjugation: Unconjugated
• MW: 64 kDa
• Target: EBF1
• UniProt ID: Q9UH73
• Protein Sequence: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EBF, COE1, OLF1, O/E-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Lin Rao, Liping Cai, Lusheng Huang, Single-cell dynamics of liver development in postnatal pigs Sci Bull., 2095-9273 (2023)

PubMed: 37783617

WB Suggested Anti-EBF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1: 312500 Positive Control: Transfected 293T

Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-EBF1 antibody