E2f7 Rabbit Polyclonal Antibody

• Catalog Number: orb329925
• Category: Antibodies
• Description: Rabbit polyclonal antibody to E2f7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2f7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 99kDa
• Target: E2f7
• UniProt ID: Q8BSQ3
• Protein Sequence: Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE
• NCBI: NP_848724
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti A630014C11Rik antibody, anti D10Ertd739e anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Note this peptide is 85% identical to the human E2F7 sequence. A 76 kDa isoform also has an 85% match to this sequence.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Sample Tissue: NIH-3T3, Antibody Dilution: 1.0 ug/mL.

Sample Type: SP2/0 Whole Cell lysates, Antibody Dilution: 0.05 ug/mL.

Mouse stomach

WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate.