Cart summary

You have no items in your shopping cart.

E2F3 Rabbit Polyclonal Antibody

SKU: orb576521

Description

Rabbit polyclonal antibody to E2F3

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
TargetE2F3
Protein SequenceSynthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

E2F-3

Similar Products

  • E2F3 Rabbit Polyclonal Antibody [orb526587]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • E2F3 Rabbit Polyclonal Antibody [orb1145757]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • E2F-3 (Acetyl Lys168) rabbit pAb Antibody [orb771322]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • E2F3 Rabbit Polyclonal Antibody [orb608082]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Human, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • E2F3 Rabbit Polyclonal Antibody [orb865691]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

E2F3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is also present in isoforms of 42 kDa and 37 kDa.

E2F3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody Dilution: 1 ug/ml.

E2F3 Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.

E2F3 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

E2F3 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 0.5 ug/ml.

E2F3 Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

E2F3 Rabbit Polyclonal Antibody

WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Thymus.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqCAH18140

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

E2F3 Rabbit Polyclonal Antibody (orb576521)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry